Lineage for d1tbrr1 (1tbr R:1-51)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144003Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily)
  4. 144004Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families) (S)
  5. 144005Family g.15.1.1: Animal Kazal-type inhibitors [57468] (7 proteins)
  6. 144048Protein Rhodniin [57476] (1 species)
  7. 144049Species Bug (Rhodnius prolixus) [TaxId:13249] [57477] (2 PDB entries)
  8. 144050Domain d1tbrr1: 1tbr R:1-51 [44707]
    Other proteins in same PDB: d1tbr.1, d1tbr.2

Details for d1tbrr1

PDB Entry: 1tbr (more details), 2.6 Å

PDB Description: crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin

SCOP Domain Sequences for d1tbrr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbrr1 g.15.1.1 (R:1-51) Rhodniin {Bug (Rhodnius prolixus)}
eggepcacphalhrvcgsdgetysnpctlncakfngkpelvkvhdgpcepd

SCOP Domain Coordinates for d1tbrr1:

Click to download the PDB-style file with coordinates for d1tbrr1.
(The format of our PDB-style files is described here.)

Timeline for d1tbrr1: