![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily) |
![]() | Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families) ![]() conserved core consists of a helix and a loop crosslinked with two disulfides |
![]() | Family g.68.1.1: Ovomucoid domain III-like [57468] (10 proteins) |
![]() | Protein Secretory trypsin inhibitor [57473] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [57475] (1 PDB entry) |
![]() | Domain d1tgsi_: 1tgs I: [44706] Other proteins in same PDB: d1tgsz_ complexed with ca, so4 |
PDB Entry: 1tgs (more details), 1.8 Å
SCOP Domain Sequences for d1tgsi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} tspqreatctsevsgcpkiynpvcgtdgitysnecvlcsenkkrqtpvliqksgpc
Timeline for d1tgsi_: