Lineage for d4ovoa_ (4ovo A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2589435Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 2589436Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 2589437Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 2589472Protein Ovomucoid domains [57469] (3 species)
    unless specified in the comment, the listed structures are of domain III
  7. 2589479Species Silver pheasant (Lophura nycthemera) [TaxId:9046] [57472] (4 PDB entries)
  8. 2589481Domain d4ovoa_: 4ovo A: [44702]

Details for d4ovoa_

PDB Entry: 4ovo (more details), 2.5 Å

PDB Description: refined x-ray crystal structures of the reactive site modified ovomucoid inhibitor third domains from silver pheasant (omsvp3(asterisk)) and from japanese quail (omjpq3(asterisk))
PDB Compounds: (A:) ovomucoid third domain cleaved rdi

SCOPe Domain Sequences for d4ovoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ovoa_ g.68.1.1 (A:) Ovomucoid domains {Silver pheasant (Lophura nycthemera) [TaxId: 9046]}
laavsvdcseypkpactmeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc

SCOPe Domain Coordinates for d4ovoa_:

Click to download the PDB-style file with coordinates for d4ovoa_.
(The format of our PDB-style files is described here.)

Timeline for d4ovoa_: