SCOPe 2.05: Domain d1ovod_: 1ovo D:

Lineage for d1ovod_ (1ovo D:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)

4. Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families)
   conserved core consists of a helix and a loop crosslinked with two disulfides

5. Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)

6. Protein Ovomucoid domains [57469] (3 species)
   unless specified in the comment, the listed structures are of domain III

7. Species Japanese quail (Coturnix coturnix japonica) [TaxId:93934] [57471] (2 PDB entries)

8. Domain d1ovod_: 1ovo D: [44700]

Details for d1ovod_

PDB Entry: 1ovo, 1.9 Å

PDB Description: crystallographic refinement of japanese quail ovomucoid, a kazal-type inhibitor, and model building studies of complexes with serine proteases

PDB Compounds: (D:) ovomucoid third domain

SCOPe Domain Sequences for d1ovod_:

Sequence; same for both SEQRES and ATOM records:

>d1ovod_ g.68.1.1 (D:) Ovomucoid domains {Japanese quail (Coturnix coturnix japonica) [TaxId: 93934]}
laavsvdcseypkpacpkdyrpvcgsdnktysnkcnfcnavvesngtltlnhfgkc

Timeline for d1ovod_:

• d1ovod_ first appeared (with stable ids) in SCOP 1.55
  
• d1ovod_ appears in SCOPe 2.04
  
• d1ovod_ appears in SCOPe 2.06
  
• d1ovod_ appears in the current release, SCOPe 2.08