![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily) |
![]() | Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) ![]() conserved core consists of a helix and a loop crosslinked with two disulfides |
![]() | Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins) |
![]() | Protein Ovomucoid domains [57469] (3 species) unless specified in the comment, the listed structures are of domain III |
![]() | Species Japanese quail (Coturnix coturnix japonica) [TaxId:93934] [57471] (2 PDB entries) |
![]() | Domain d1ovoc_: 1ovo C: [44699] |
PDB Entry: 1ovo (more details), 1.9 Å
SCOPe Domain Sequences for d1ovoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ovoc_ g.68.1.1 (C:) Ovomucoid domains {Japanese quail (Coturnix coturnix japonica) [TaxId: 93934]} laavsvdcseypkpacpkdyrpvcgsdnktysnkcnfcnavvesngtltlnhfgkc
Timeline for d1ovoc_: