Lineage for d1ovob_ (1ovo B:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264880Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 2264881Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 2264882Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 2264917Protein Ovomucoid domains [57469] (3 species)
    unless specified in the comment, the listed structures are of domain III
  7. 2264918Species Japanese quail (Coturnix coturnix japonica) [TaxId:93934] [57471] (2 PDB entries)
  8. 2264921Domain d1ovob_: 1ovo B: [44698]

Details for d1ovob_

PDB Entry: 1ovo (more details), 1.9 Å

PDB Description: crystallographic refinement of japanese quail ovomucoid, a kazal-type inhibitor, and model building studies of complexes with serine proteases
PDB Compounds: (B:) ovomucoid third domain

SCOPe Domain Sequences for d1ovob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovob_ g.68.1.1 (B:) Ovomucoid domains {Japanese quail (Coturnix coturnix japonica) [TaxId: 93934]}
laavsvdcseypkpacpkdyrpvcgsdnktysnkcnfcnavvesngtltlnhfgkc

SCOPe Domain Coordinates for d1ovob_:

Click to download the PDB-style file with coordinates for d1ovob_.
(The format of our PDB-style files is described here.)

Timeline for d1ovob_: