SCOP 1.69: Domain d1ovob_: 1ovo B:

Lineage for d1ovob_ (1ovo B:)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)

4. Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families)
   conserved core consists of a helix and a loop crosslinked with two disulfides

5. Family g.68.1.1: Ovomucoid domain III-like [57468] (10 proteins)

6. Protein Ovomucoid domains [57469] (3 species)
   unless specified in the comment, the listed structures are of domain III

7. Species Japanese quail (Coturnix coturnix japonica) [TaxId:93934] [57471] (2 PDB entries)

8. Domain d1ovob_: 1ovo B: [44698]

Details for d1ovob_

PDB Entry: 1ovo, 1.9 Å

PDB Description: crystallographic refinement of japanese quail ovomucoid, a kazal-type inhibitor, and model building studies of complexes with serine proteases

SCOP Domain Sequences for d1ovob_:

Sequence; same for both SEQRES and ATOM records:

>d1ovob_ g.68.1.1 (B:) Ovomucoid domains {Japanese quail (Coturnix coturnix japonica)}
laavsvdcseypkpacpkdyrpvcgsdnktysnkcnfcnavvesngtltlnhfgkc

Timeline for d1ovob_:

• d1ovob_ first appeared (with stable ids) in SCOP 1.55
  
• d1ovob_ appears in SCOP 1.67
  
• d1ovob_ appears in SCOP 1.71
  
• d1ovob_ appears in the current release, SCOPe 2.08