Lineage for d1ovoa_ (1ovo A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2643121Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 2643122Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 2643123Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 2643158Protein Ovomucoid domains [57469] (3 species)
    unless specified in the comment, the listed structures are of domain III
  7. 2643159Species Japanese quail (Coturnix coturnix japonica) [TaxId:93934] [57471] (2 PDB entries)
  8. 2643161Domain d1ovoa_: 1ovo A: [44697]

Details for d1ovoa_

PDB Entry: 1ovo (more details), 1.9 Å

PDB Description: crystallographic refinement of japanese quail ovomucoid, a kazal-type inhibitor, and model building studies of complexes with serine proteases
PDB Compounds: (A:) ovomucoid third domain

SCOPe Domain Sequences for d1ovoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovoa_ g.68.1.1 (A:) Ovomucoid domains {Japanese quail (Coturnix coturnix japonica) [TaxId: 93934]}
laavsvdcseypkpacpkdyrpvcgsdnktysnkcnfcnavvesngtltlnhfgkc

SCOPe Domain Coordinates for d1ovoa_:

Click to download the PDB-style file with coordinates for d1ovoa_.
(The format of our PDB-style files is described here.)

Timeline for d1ovoa_: