SCOPe 2.06: Domain d3ovoa_: 3ovo A:

Lineage for d3ovoa_ (3ovo A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)

4. Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families)
   conserved core consists of a helix and a loop crosslinked with two disulfides

5. Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)

6. Protein Ovomucoid domains [57469] (3 species)
   unless specified in the comment, the listed structures are of domain III

7. Species Japanese quail (Coturnix coturnix japonica) [TaxId:93934] [57471] (2 PDB entries)

8. Domain d3ovoa_: 3ovo A: [44696]

Details for d3ovoa_

PDB Entry: 3ovo, 1.55 Å

PDB Description: refined x-ray crystal structures of the reactive site modified ovomucoid inhibitor third domains from silver pheasant (omsvp3(asterisk)) and from japanese quail (omjpq3(asterisk))

PDB Compounds: (A:) ovomucoid third domain cleaved rdi

SCOPe Domain Sequences for d3ovoa_:

Sequence; same for both SEQRES and ATOM records:

>d3ovoa_ g.68.1.1 (A:) Ovomucoid domains {Japanese quail (Coturnix coturnix japonica) [TaxId: 93934]}
laavsvdcseypkpacpkdyrpvcgsdnktysnkcnfcnavvesngtltlnhfgkc

Timeline for d3ovoa_:

• d3ovoa_ first appeared (with stable ids) in SCOP 1.55, called d3ovo__
  
• d3ovoa_ appears in SCOPe 2.05
  
• d3ovoa_ appears in SCOPe 2.07
  
• d3ovoa_ appears in the current release, SCOPe 2.08