Lineage for d3ovoa_ (3ovo A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2589435Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 2589436Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 2589437Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 2589472Protein Ovomucoid domains [57469] (3 species)
    unless specified in the comment, the listed structures are of domain III
  7. 2589473Species Japanese quail (Coturnix coturnix japonica) [TaxId:93934] [57471] (2 PDB entries)
  8. 2589474Domain d3ovoa_: 3ovo A: [44696]

Details for d3ovoa_

PDB Entry: 3ovo (more details), 1.55 Å

PDB Description: refined x-ray crystal structures of the reactive site modified ovomucoid inhibitor third domains from silver pheasant (omsvp3(asterisk)) and from japanese quail (omjpq3(asterisk))
PDB Compounds: (A:) ovomucoid third domain cleaved rdi

SCOPe Domain Sequences for d3ovoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ovoa_ g.68.1.1 (A:) Ovomucoid domains {Japanese quail (Coturnix coturnix japonica) [TaxId: 93934]}
laavsvdcseypkpacpkdyrpvcgsdnktysnkcnfcnavvesngtltlnhfgkc

SCOPe Domain Coordinates for d3ovoa_:

Click to download the PDB-style file with coordinates for d3ovoa_.
(The format of our PDB-style files is described here.)

Timeline for d3ovoa_: