SCOP 1.65: Domain d1hjai_: 1hja I:

Lineage for d1hjai_ (1hja I:)

1. Root: SCOP 1.65

2. Class g: Small proteins [56992] (66 folds)

3. Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily)
   disulphide-rich small alpha+beta fold

4. Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families)
   two families share the same beta-sheet topology but differ in the active-site loop location

5. Family g.15.1.1: Animal Kazal-type inhibitors [57468] (10 proteins)

6. Protein Ovomucoid III domain [57469] (3 species)

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (20 PDB entries)

8. Domain d1hjai_: 1hja I: [44691]
   Other proteins in same PDB: d1hja.1
   mutant

Details for d1hjai_

PDB Entry: 1hja, 2.3 Å

PDB Description: lys 18 variant of turkey ovomucoid inhibitor third domain complexed with alpha-chymotrypsin

SCOP Domain Sequences for d1hjai_:

Sequence; same for both SEQRES and ATOM records:

>d1hjai_ g.15.1.1 (I:) Ovomucoid III domain {Turkey (Meleagris gallopavo)}
vdcseypkpactkeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc

Timeline for d1hjai_:

• d1hjai_ first appeared (with stable ids) in SCOP 1.55
  
• d1hjai_ appears in SCOP 1.63
  
• d1hjai_ appears in SCOP 1.67
  
• d1hjai_ appears in the current release, SCOPe 2.08