Lineage for d1ds2i_ (1ds2 I:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524884Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 524885Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 524886Family g.68.1.1: Ovomucoid domain III-like [57468] (10 proteins)
  6. 524918Protein Ovomucoid domains [57469] (3 species)
    unless specified in the comment, the listed structures are of domain III
  7. 524930Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (31 PDB entries)
  8. 524942Domain d1ds2i_: 1ds2 I: [44687]
    Other proteins in same PDB: d1ds2e_

Details for d1ds2i_

PDB Entry: 1ds2 (more details), 1.7 Å

PDB Description: crystal structure of sgpb:omtky3-coo-leu18i

SCOP Domain Sequences for d1ds2i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ds2i_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo)}
vdcseypkpactxeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc

SCOP Domain Coordinates for d1ds2i_:

Click to download the PDB-style file with coordinates for d1ds2i_.
(The format of our PDB-style files is described here.)

Timeline for d1ds2i_:

524942
d1ds2i_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1ds2e_