Lineage for d1ds2i_ (1ds2 I:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40708Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily)
  4. 40709Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families) (S)
  5. 40710Family g.15.1.1: Animal Kazal-type inhibitors [57468] (7 proteins)
  6. 40721Protein Ovomucoid III domain [57469] (3 species)
  7. 40731Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (18 PDB entries)
  8. 40741Domain d1ds2i_: 1ds2 I: [44687]
    Other proteins in same PDB: d1ds2e_

Details for d1ds2i_

PDB Entry: 1ds2 (more details), 1.7 Å

PDB Description: crystal structure of sgpb:omtky3-coo-leu18i

SCOP Domain Sequences for d1ds2i_:

Sequence, based on SEQRES records: (download)

>d1ds2i_ g.15.1.1 (I:) Ovomucoid III domain {Turkey (Meleagris gallopavo)}
vdcseypkpactxeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc

Sequence, based on observed residues (ATOM records): (download)

>d1ds2i_ g.15.1.1 (I:) Ovomucoid III domain {Turkey (Meleagris gallopavo)}
vdcseypkpacteyrplcgsdnktygnkcnfcnavvesngtltlshfgkc

SCOP Domain Coordinates for d1ds2i_:

Click to download the PDB-style file with coordinates for d1ds2i_.
(The format of our PDB-style files is described here.)

Timeline for d1ds2i_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ds2e_