Lineage for d1ct4i_ (1ct4 I:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 751855Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 751856Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 751857Family g.68.1.1: Ovomucoid domain III-like [57468] (10 proteins)
  6. 751889Protein Ovomucoid domains [57469] (3 species)
    unless specified in the comment, the listed structures are of domain III
  7. 751901Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (35 PDB entries)
  8. 751907Domain d1ct4i_: 1ct4 I: [44681]
    Other proteins in same PDB: d1ct4e_

Details for d1ct4i_

PDB Entry: 1ct4 (more details), 1.6 Å

PDB Description: crystal structure of the omtky3 p1 variant omtky3-val18i in complex with sgpb
PDB Compounds: (I:) ovomucoid inhibitor

SCOP Domain Sequences for d1ct4i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ct4i_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]}
vdcseypkpactveyrplcgsdnktygnkcnfcnavvesngtltlshfgkc

SCOP Domain Coordinates for d1ct4i_:

Click to download the PDB-style file with coordinates for d1ct4i_.
(The format of our PDB-style files is described here.)

Timeline for d1ct4i_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ct4e_