Lineage for d1sgpi_ (1sgp I:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2589435Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 2589436Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 2589437Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 2589472Protein Ovomucoid domains [57469] (3 species)
    unless specified in the comment, the listed structures are of domain III
  7. 2589484Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (36 PDB entries)
  8. 2589495Domain d1sgpi_: 1sgp I: [44678]
    Other proteins in same PDB: d1sgpe_
    complexed with po4

Details for d1sgpi_

PDB Entry: 1sgp (more details), 1.4 Å

PDB Description: ala 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
PDB Compounds: (I:) turkey ovomucoid inhibitor

SCOPe Domain Sequences for d1sgpi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgpi_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]}
vdcseypkpactaeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc

SCOPe Domain Coordinates for d1sgpi_:

Click to download the PDB-style file with coordinates for d1sgpi_.
(The format of our PDB-style files is described here.)

Timeline for d1sgpi_: