Lineage for d1cxwa_ (1cxw A:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89571Fold g.14: Kringle-like [57439] (1 superfamily)
  4. 89572Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 89631Family g.14.1.2: Fibronectin type II module [57459] (3 proteins)
  6. 89640Protein Gelatinase A (MMP-2) type II modules [57464] (1 species)
  7. 89641Species Human (Homo sapiens) [TaxId:9606] [57465] (3 PDB entries)
  8. 89645Domain d1cxwa_: 1cxw A: [44677]

Details for d1cxwa_

PDB Entry: 1cxw (more details)

PDB Description: the second type ii module from human matrix metalloproteinase 2

SCOP Domain Sequences for d1cxwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxwa_ g.14.1.2 (A:) Gelatinase A (MMP-2) type II modules {Human (Homo sapiens)}
talftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygfcpeta

SCOP Domain Coordinates for d1cxwa_:

Click to download the PDB-style file with coordinates for d1cxwa_.
(The format of our PDB-style files is described here.)

Timeline for d1cxwa_: