SCOPe 2.05: Domain d1ck7a5: 1ck7 A:336-393

Lineage for d1ck7a5 (1ck7 A:336-393)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
   shorter two-disulfide version of a kringle module

6. Protein Gelatinase A (MMP-2) type II modules [57464] (1 species)
   duplication: tandem repeat of three modules inserted in the catalytic domain

7. Species Human (Homo sapiens) [TaxId:9606] [57465] (6 PDB entries)

8. Domain d1ck7a5: 1ck7 A:336-393 [44676]
   Other proteins in same PDB: d1ck7a1, d1ck7a6, d1ck7a7
   complexed with ca, cl, na, so4, zn

Details for d1ck7a5

PDB Entry: 1ck7, 2.8 Å

PDB Description: gelatinase a (full-length)

PDB Compounds: (A:) protein (gelatinase a)

SCOPe Domain Sequences for d1ck7a5:

Sequence; same for both SEQRES and ATOM records:

>d1ck7a5 g.14.1.2 (A:336-393) Gelatinase A (MMP-2) type II modules {Human (Homo sapiens) [TaxId: 9606]}
amstvggnsegapcvfpftflgnkyesctsagrsdgkmwcattanydddrkwgfcpdq

Timeline for d1ck7a5:

• d1ck7a5 first appeared (with stable ids) in SCOP 1.55
  
• d1ck7a5 appears in SCOPe 2.04
  
• d1ck7a5 appears in SCOPe 2.06
  
• d1ck7a5 appears in the current release, SCOPe 2.08