Lineage for d1ck7a5 (1ck7 A:336-393)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 143909Fold g.14: Kringle-like [57439] (1 superfamily)
  4. 143910Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 143983Family g.14.1.2: Fibronectin type II module [57459] (3 proteins)
  6. 143992Protein Gelatinase A (MMP-2) type II modules [57464] (1 species)
  7. 143993Species Human (Homo sapiens) [TaxId:9606] [57465] (4 PDB entries)
  8. 143996Domain d1ck7a5: 1ck7 A:336-393 [44676]
    Other proteins in same PDB: d1ck7a1, d1ck7a6, d1ck7a7

Details for d1ck7a5

PDB Entry: 1ck7 (more details), 2.8 Å

PDB Description: gelatinase a (full-length)

SCOP Domain Sequences for d1ck7a5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ck7a5 g.14.1.2 (A:336-393) Gelatinase A (MMP-2) type II modules {Human (Homo sapiens)}
amstvggnsegapcvfpftflgnkyesctsagrsdgkmwcattanydddrkwgfcpdq

SCOP Domain Coordinates for d1ck7a5:

Click to download the PDB-style file with coordinates for d1ck7a5.
(The format of our PDB-style files is described here.)

Timeline for d1ck7a5: