Class g: Small proteins [56992] (72 folds) |
Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (2 families) |
Family g.14.1.2: Fibronectin type II module [57459] (4 proteins) shorter two-disulfide version of a kringle module |
Protein Gelatinase A (MMP-2) type II modules [57464] (1 species) duplication: tandem repeat of three modules inserted in the catalytic domain |
Species Human (Homo sapiens) [TaxId:9606] [57465] (6 PDB entries) |
Domain d1ck7a4: 1ck7 A:278-335 [44675] Other proteins in same PDB: d1ck7a1, d1ck7a6, d1ck7a7 |
PDB Entry: 1ck7 (more details), 2.8 Å
SCOP Domain Sequences for d1ck7a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ck7a4 g.14.1.2 (A:278-335) Gelatinase A (MMP-2) type II modules {Human (Homo sapiens)} alftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygfcpet
Timeline for d1ck7a4: