| Class g: Small proteins [56992] (79 folds) |
| Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (2 families) ![]() |
| Family g.14.1.2: Fibronectin type II module [57459] (4 proteins) shorter two-disulfide version of a kringle module |
| Protein Fibronectin [57462] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57463] (4 PDB entries) |
| Domain d1qo6a1: 1qo6 A:42-101 [44673] Other proteins in same PDB: d1qo6a2 |
PDB Entry: 1qo6 (more details)
SCOP Domain Sequences for d1qo6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qo6a1 g.14.1.2 (A:42-101) Fibronectin {Human (Homo sapiens)}
avtqtyggnsngepcvlpftyngrtfyscttegrqdghlwcsttsnyeqdqkysfctdht
Timeline for d1qo6a1: