Lineage for d1e88a2 (1e88 A:102-160)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1461545Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 1461546Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 1461653Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
    shorter two-disulfide version of a kringle module
  6. 1461654Protein Fibronectin [57462] (1 species)
  7. 1461655Species Human (Homo sapiens) [TaxId:9606] [57463] (4 PDB entries)
  8. 1461659Domain d1e88a2: 1e88 A:102-160 [44670]
    Other proteins in same PDB: d1e88a3
    complexed with nag

Details for d1e88a2

PDB Entry: 1e88 (more details)

PDB Description: solution structure of 6f11f22f2, a compact three-module fragment of the gelatin-binding domain of human fibronectin
PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d1e88a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e88a2 g.14.1.2 (A:102-160) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
vlvqtrggnsngalchfpflynnhnytdctsegrrdnmkwcgttqnydadqkfgfcpma

SCOPe Domain Coordinates for d1e88a2:

Click to download the PDB-style file with coordinates for d1e88a2.
(The format of our PDB-style files is described here.)

Timeline for d1e88a2: