Lineage for d2fn2__ (2fn2 -)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623175Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 623176Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 623254Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
    shorter two-disulfide version of a kringle module
  6. 623255Protein Fibronectin [57462] (1 species)
  7. 623256Species Human (Homo sapiens) [TaxId:9606] [57463] (4 PDB entries)
  8. 623260Domain d2fn2__: 2fn2 - [44668]
    complexed with nag

Details for d2fn2__

PDB Entry: 2fn2 (more details)

PDB Description: solution nmr structure of the glycosylated second type two module of fibronectin, 20 structures

SCOP Domain Sequences for d2fn2__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fn2__ g.14.1.2 (-) Fibronectin {Human (Homo sapiens)}
vlvqtrggnsngalchfpflynnhnytdctsegrrdnmkwcgttqnydadqkfgfcpma

SCOP Domain Coordinates for d2fn2__:

Click to download the PDB-style file with coordinates for d2fn2__.
(The format of our PDB-style files is described here.)

Timeline for d2fn2__: