Lineage for d1pdca_ (1pdc A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890943Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 890944Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 891041Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
    shorter two-disulfide version of a kringle module
  6. 891081Protein PDC-109, collagen-binding type II domain [57460] (1 species)
  7. 891082Species Cow (Bos taurus) [TaxId:9913] [57461] (2 PDB entries)
  8. 891087Domain d1pdca_: 1pdc A: [44667]

Details for d1pdca_

PDB Entry: 1pdc (more details)

PDB Description: refined solution structure and ligand-binding properties of pdc-109 domain b. a collagen-binding type ii domain
PDB Compounds: (A:) seminal fluid protein pdc-109

SCOP Domain Sequences for d1pdca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdca_ g.14.1.2 (A:) PDC-109, collagen-binding type II domain {Cow (Bos taurus) [TaxId: 9913]}
dyakcvfpfiyggkkyetctkigsmwmswcslspnydkdrawkyc

SCOP Domain Coordinates for d1pdca_:

Click to download the PDB-style file with coordinates for d1pdca_.
(The format of our PDB-style files is described here.)

Timeline for d1pdca_: