Lineage for d1nk1b2 (1nk1 B:126-209)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1461545Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 1461546Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 1461547Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 1461564Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)
  7. 1461565Species Human (Homo sapiens) [TaxId:9606] [57458] (6 PDB entries)
  8. 1461577Domain d1nk1b2: 1nk1 B:126-209 [44666]
    Other proteins in same PDB: d1nk1a1, d1nk1b1

Details for d1nk1b2

PDB Entry: 1nk1 (more details), 2.5 Å

PDB Description: nk1 fragment of human hepatocyte growth factor/scatter factor (hgf/sf) at 2.5 angstrom resolution
PDB Compounds: (B:) protein (hepatocyte growth factor precursor)

SCOPe Domain Sequences for d1nk1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nk1b2 g.14.1.1 (B:126-209) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
rnciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeeg
gpwcftsnpevryevcdipqcsev

SCOPe Domain Coordinates for d1nk1b2:

Click to download the PDB-style file with coordinates for d1nk1b2.
(The format of our PDB-style files is described here.)

Timeline for d1nk1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nk1b1