SCOPe 2.07: Domain d1bhtb2: 1bht B:427-509

Lineage for d1bhtb2 (1bht B:427-509)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57458] (18 PDB entries)

8. Domain d1bhtb2: 1bht B:427-509 [44664]
   Other proteins in same PDB: d1bhta1, d1bhtb1
   complexed with epe, so4

Details for d1bhtb2

PDB Entry: 1bht, 2 Å

PDB Description: nk1 fragment of human hepatocyte growth factor

PDB Compounds: (B:) hepatocyte growth factor

SCOPe Domain Sequences for d1bhtb2:

Sequence; same for both SEQRES and ATOM records:

>d1bhtb2 g.14.1.1 (B:427-509) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
nciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeegg
pwcftsnpevryevcdipqcsev

Timeline for d1bhtb2:

• d1bhtb2 first appeared (with stable ids) in SCOP 1.55
  
• d1bhtb2 appears in SCOPe 2.06
  
• d1bhtb2 appears in the current release, SCOPe 2.08