Lineage for d1bhtb2 (1bht B:427-509)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [57458] (20 PDB entries)
  8. Domain d1bhtb2: 1bht B:427-509 [44664]
    Other proteins in same PDB: d1bhta1, d1bhtb1
    complexed with epe, so4

Details for d1bhtb2

PDB Entry: 1bht (more details), 2 Å

PDB Description: nk1 fragment of human hepatocyte growth factor
PDB Compounds: (B:) hepatocyte growth factor

SCOPe Domain Sequences for d1bhtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhtb2 g.14.1.1 (B:427-509) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
nciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeegg
pwcftsnpevryevcdipqcsev

SCOPe Domain Coordinates for d1bhtb2 are not available.

Timeline for d1bhtb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bhtb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1bhta1, d1bhta2