Lineage for d1bhta2 (1bht A:127-210)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40632Fold g.14: Kringle-like [57439] (1 superfamily)
  4. 40633Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 40634Family g.14.1.1: Kringle modules [57441] (8 proteins)
  6. 40647Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)
  7. 40648Species Human (Homo sapiens) [TaxId:9606] [57458] (2 PDB entries)
  8. 40649Domain d1bhta2: 1bht A:127-210 [44663]
    Other proteins in same PDB: d1bhta1, d1bhtb1

Details for d1bhta2

PDB Entry: 1bht (more details), 2 Å

PDB Description: nk1 fragment of human hepatocyte growth factor

SCOP Domain Sequences for d1bhta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhta2 g.14.1.1 (A:127-210) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens)}
nciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeegg
pwcftsnpevryevcdipqcseve

SCOP Domain Coordinates for d1bhta2:

Click to download the PDB-style file with coordinates for d1bhta2.
(The format of our PDB-style files is described here.)

Timeline for d1bhta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bhta1