Lineage for d4kiv__ (4kiv -)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623175Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 623176Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 623177Family g.14.1.1: Kringle modules [57441] (6 proteins)
  6. 623178Protein Apolipoprotein A [57455] (3 species)
  7. 623179Species Human (Homo sapiens), IV-10/M66 variant [TaxId:9606] [57456] (3 PDB entries)
  8. 623182Domain d4kiv__: 4kiv - [44662]
    mutant

Details for d4kiv__

PDB Entry: 4kiv (more details), 2.2 Å

PDB Description: recombinant kringle iv-10/w72r mutant of human apolipoprotein(a)

SCOP Domain Sequences for d4kiv__:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kiv__ g.14.1.1 (-) Apolipoprotein A {Human (Homo sapiens), IV-10/M66 variant}
qcyhgngqsyrgtfsttvtgrtcqswssmtphrhqrtpenypndgltmnycrnpdadtgp
wcftmdpsirreycnltrc

SCOP Domain Coordinates for d4kiv__:

Click to download the PDB-style file with coordinates for d4kiv__.
(The format of our PDB-style files is described here.)

Timeline for d4kiv__: