SCOP 1.67: Domain d4kiv__: 4kiv -

Lineage for d4kiv__ (4kiv -)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (2 families)

5. Family g.14.1.1: Kringle modules [57441] (6 proteins)

6. Protein Apolipoprotein A [57455] (3 species)

7. Species Human (Homo sapiens), IV-10/M66 variant [TaxId:9606] [57456] (3 PDB entries)

8. Domain d4kiv__: 4kiv - [44662]
   mutant

Details for d4kiv__

PDB Entry: 4kiv, 2.2 Å

PDB Description: recombinant kringle iv-10/w72r mutant of human apolipoprotein(a)

SCOP Domain Sequences for d4kiv__:

Sequence; same for both SEQRES and ATOM records:

>d4kiv__ g.14.1.1 (-) Apolipoprotein A {Human (Homo sapiens), IV-10/M66 variant}
qcyhgngqsyrgtfsttvtgrtcqswssmtphrhqrtpenypndgltmnycrnpdadtgp
wcftmdpsirreycnltrc

Timeline for d4kiv__:

• d4kiv__ first appeared (with stable ids) in SCOP 1.55
  
• d4kiv__ appears in SCOP 1.65
  
• d4kiv__ appears in SCOP 1.69
  
• d4kiv__ appears in the current release, SCOPe 2.08, called d4kiva_