Lineage for d4kiv__ (4kiv -)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.14: Kringle-like [57439] (1 superfamily) Superfamily g.14.1: Kringle-like [57440] (2 families) 
Family g.14.1.1: Kringle modules [57441] (8 proteins) 
Protein Apolipoprotein (A) IV-10/M66 variant [57455] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57456] (3 PDB entries) 
Domain d4kiv__: 4kiv - [44662]
Details for d4kiv__
PDB Entry: 4kiv (more details), 2.2 Å
PDB Description: recombinant kringle iv-10/w72r mutant of human apolipoprotein(a)
SCOP Domain Sequences for d4kiv__:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kiv__ g.14.1.1 (-) Apolipoprotein (A) IV-10/M66 variant {Human (Homo sapiens)}
qcyhgngqsyrgtfsttvtgrtcqswssmtphrhqrtpenypndgltmnycrnpdadtgp
wcftmdpsirreycnltrc
SCOP Domain Coordinates for d4kiv__:
Click to download the PDB-style file with coordinates for d4kiv__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4kiv__:
- d4kiv__ appears in SCOP 1.57
- d4kiv__ appears in the current release, SCOPe 2.08, called d4kiva_
View in 3D