Lineage for d1kiv__ (1kiv -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40632Fold g.14: Kringle-like [57439] (1 superfamily)
  4. 40633Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 40634Family g.14.1.1: Kringle modules [57441] (8 proteins)
  6. 40635Protein Apolipoprotein (A) IV-10/M66 variant [57455] (1 species)
  7. 40636Species Human (Homo sapiens) [TaxId:9606] [57456] (3 PDB entries)
  8. 40638Domain d1kiv__: 1kiv - [44661]

Details for d1kiv__

PDB Entry: 1kiv (more details), 2.1 Å

PDB Description: recombinant kringle iv-10/m66 variant of human apolipoprotein(a)

SCOP Domain Sequences for d1kiv__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kiv__ g.14.1.1 (-) Apolipoprotein (A) IV-10/M66 variant {Human (Homo sapiens)}
cyhgngqsyrgtfsttvtgrtcqswssmtphrhqrtpenypndgltmnycrnpdadtgpw
cftmdpsirweycnltrc

SCOP Domain Coordinates for d1kiv__:

Click to download the PDB-style file with coordinates for d1kiv__.
(The format of our PDB-style files is described here.)

Timeline for d1kiv__: