SCOP 1.67: Domain d3kiv__: 3kiv -

Lineage for d3kiv__ (3kiv -)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (2 families)

5. Family g.14.1.1: Kringle modules [57441] (6 proteins)

6. Protein Apolipoprotein A [57455] (3 species)

7. Species Human (Homo sapiens), IV-10/M66 variant [TaxId:9606] [57456] (3 PDB entries)

8. Domain d3kiv__: 3kiv - [44660]
   complexed with aca

Details for d3kiv__

PDB Entry: 3kiv, 1.8 Å

PDB Description: recombinant kringle iv-10/m66 variant of human apolipoprotein(a)

SCOP Domain Sequences for d3kiv__:

Sequence; same for both SEQRES and ATOM records:

>d3kiv__ g.14.1.1 (-) Apolipoprotein A {Human (Homo sapiens), IV-10/M66 variant}
qcyhgngqsyrgtfsttvtgrtcqswssmtphrhqrtpenypndgltmnycrnpdadtgp
wcfttdpsirweycnltrc

Timeline for d3kiv__:

• d3kiv__ first appeared (with stable ids) in SCOP 1.55
  
• d3kiv__ appears in SCOP 1.65
  
• d3kiv__ appears in SCOP 1.69
  
• d3kiv__ appears in the current release, SCOPe 2.08, called d3kiva_