Lineage for d1urk_2 (1urk 50-135)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 343037Fold g.14: Kringle-like [57439] (1 superfamily)
    disulphide-rich fold; nearly all-beta
  4. 343038Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 343039Family g.14.1.1: Kringle modules [57441] (6 proteins)
  6. 343110Protein Urokinase-type plasminogen activator [57453] (1 species)
  7. 343111Species Human (Homo sapiens) [TaxId:9606] [57454] (2 PDB entries)
  8. 343113Domain d1urk_2: 1urk 50-135 [44659]
    Other proteins in same PDB: d1urk_1
    complexed with fuc

Details for d1urk_2

PDB Entry: 1urk (more details)

PDB Description: solution structure of the amino terminal fragment of urokinase-type plasminogen activator

SCOP Domain Sequences for d1urk_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urk_2 g.14.1.1 (50-135) Urokinase-type plasminogen activator {Human (Homo sapiens)}
cyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrr
rpwcyvqvglkplvqecmvhdcadgk

SCOP Domain Coordinates for d1urk_2:

Click to download the PDB-style file with coordinates for d1urk_2.
(The format of our PDB-style files is described here.)

Timeline for d1urk_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1urk_1