Lineage for d1kdua_ (1kdu A:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 748907Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 748908Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 748909Family g.14.1.1: Kringle modules [57441] (6 proteins)
  6. 748988Protein Urokinase-type plasminogen activator [57453] (1 species)
  7. 748989Species Human (Homo sapiens) [TaxId:9606] [57454] (5 PDB entries)
  8. 748999Domain d1kdua_: 1kdu A: [44658]

Details for d1kdua_

PDB Entry: 1kdu (more details)

PDB Description: sequential 1h nmr assignments and secondary structure of the kringle domain from urokinase
PDB Compounds: (A:) plasminogen activator

SCOP Domain Sequences for d1kdua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kdua_ g.14.1.1 (A:) Urokinase-type plasminogen activator {Human (Homo sapiens) [TaxId: 9606]}
tcyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnr
rrpwcyvqvglkplvqecmvhdcad

SCOP Domain Coordinates for d1kdua_:

Click to download the PDB-style file with coordinates for d1kdua_.
(The format of our PDB-style files is described here.)

Timeline for d1kdua_: