Lineage for d1kdu__ (1kdu -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40632Fold g.14: Kringle-like [57439] (1 superfamily)
  4. 40633Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 40634Family g.14.1.1: Kringle modules [57441] (8 proteins)
  6. 40686Protein Urokinase-type plasminogen activator [57453] (1 species)
  7. 40687Species Human (Homo sapiens) [TaxId:9606] [57454] (2 PDB entries)
  8. 40688Domain d1kdu__: 1kdu - [44658]

Details for d1kdu__

PDB Entry: 1kdu (more details)

PDB Description: sequential 1h nmr assignments and secondary structure of the kringle domain from urokinase

SCOP Domain Sequences for d1kdu__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kdu__ g.14.1.1 (-) Urokinase-type plasminogen activator {Human (Homo sapiens)}
tcyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnr
rrpwcyvqvglkplvqecmvhdcad

SCOP Domain Coordinates for d1kdu__:

Click to download the PDB-style file with coordinates for d1kdu__.
(The format of our PDB-style files is described here.)

Timeline for d1kdu__: