SCOPe 2.06: Domain d2hpqp_: 2hpq P:

Lineage for d2hpqp_ (2hpq P:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein Meizothrombin [57450] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57452] (1 PDB entry)

8. Domain d2hpqp_: 2hpq P: [44657]
   Other proteins in same PDB: d2hpq.1
   complexed with 0g7

Details for d2hpqp_

PDB Entry: 2hpq, 3.3 Å

PDB Description: Structures of the noncovalent complexes of human and bovine prothrombin fragment 2 with human ppack-thrombin

PDB Compounds: (P:) Prothrombin

SCOPe Domain Sequences for d2hpqp_:

Sequence; same for both SEQRES and ATOM records:

>d2hpqp_ g.14.1.1 (P:) Meizothrombin {Human (Homo sapiens) [TaxId: 9606]}
cvpdrgqqyqgrlavtthglpclawasaqakalskhqdfnsavqlvenfcrnpdgdeegv
wcyvagkpgdfgycdlnyc

Timeline for d2hpqp_:

• d2hpqp_ first appeared (with stable ids) in SCOP 1.55
  
• d2hpqp_ appears in SCOPe 2.05
  
• d2hpqp_ appears in SCOPe 2.07
  
• d2hpqp_ appears in the current release, SCOPe 2.08