Class g: Small proteins [56992] (90 folds) |
Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (2 families) |
Family g.14.1.1: Kringle modules [57441] (6 proteins) |
Protein Meizothrombin [57450] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [57451] (2 PDB entries) |
Domain d1a0hd1: 1a0h D:164-270 [44656] Other proteins in same PDB: d1a0h.1, d1a0h.2 complexed with ch2, nag |
PDB Entry: 1a0h (more details), 3.2 Å
SCOP Domain Sequences for d1a0hd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a0hd1 g.14.1.1 (D:164-270) Meizothrombin {Cow (Bos taurus) [TaxId: 9913]} splletcvpdrgreyrgrlavtthgsrclawsseqakalskdqdfnpavplaenfcrnpd gdeegawcyvadqpgdfeycdlnyceepvdgdlgdrlgedpdpdaaieg
Timeline for d1a0hd1:
View in 3D Domains from other chains: (mouse over for more information) d1a0h.1, d1a0h.1, d1a0h.2, d1a0ha1 |