SCOPe 2.08: Domain d1a0ha1: 1a0h A:164-270

Lineage for d1a0ha1 (1a0h A:164-270)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein Meizothrombin [57450] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57451] (2 PDB entries)

8. Domain d1a0ha1: 1a0h A:164-270 [44655]
   Other proteins in same PDB: d1a0h.1, d1a0h.2
   complexed with 0g6

Details for d1a0ha1

PDB Entry: 1a0h, 3.2 Å

PDB Description: the x-ray crystal structure of ppack-meizothrombin desf1: kringle/thrombin and carbohydrate/kringle/thrombin interactions and location of the linker chain

PDB Compounds: (A:) meizothrombin

SCOPe Domain Sequences for d1a0ha1:

Sequence; same for both SEQRES and ATOM records:

>d1a0ha1 g.14.1.1 (A:164-270) Meizothrombin {Cow (Bos taurus) [TaxId: 9913]}
splletcvpdrgreyrgrlavtthgsrclawsseqakalskdqdfnpavplaenfcrnpd
gdeegawcyvadqpgdfeycdlnyceepvdgdlgdrlgedpdpdaaieg

Timeline for d1a0ha1:

• d1a0ha1 first appeared (with stable ids) in SCOP 1.55
  
• d1a0ha1 appears in SCOPe 2.07