Lineage for d2hppp_ (2hpp P:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1063790Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 1063791Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 1063792Family g.14.1.1: Kringle modules [57441] (6 proteins)
  6. 1063802Protein Meizothrombin [57450] (2 species)
  7. 1063803Species Cow (Bos taurus) [TaxId:9913] [57451] (2 PDB entries)
  8. 1063804Domain d2hppp_: 2hpp P: [44654]
    Other proteins in same PDB: d2hpp.1
    complexed with 0g7

Details for d2hppp_

PDB Entry: 2hpp (more details), 3.3 Å

PDB Description: Structures of the noncovalent complexes of human and bovine prothrombin fragment 2 with human ppack-thrombin
PDB Compounds: (P:) Prothrombin

SCOPe Domain Sequences for d2hppp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hppp_ g.14.1.1 (P:) Meizothrombin {Cow (Bos taurus) [TaxId: 9913]}
cvpdrgreyrgrlavttsgsrclawsseqakalskdqdfnpavplaenfcrnpdgdeega
wcyvadqpgdfeycnlnyc

SCOPe Domain Coordinates for d2hppp_:

Click to download the PDB-style file with coordinates for d2hppp_.
(The format of our PDB-style files is described here.)

Timeline for d2hppp_: