Class g: Small proteins [56992] (90 folds) |
Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (2 families) |
Family g.14.1.1: Kringle modules [57441] (6 proteins) |
Protein Meizothrombin [57450] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [57451] (2 PDB entries) |
Domain d2hppp_: 2hpp P: [44654] Other proteins in same PDB: d2hpp.1 complexed with 0g7 |
PDB Entry: 2hpp (more details), 3.3 Å
SCOPe Domain Sequences for d2hppp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hppp_ g.14.1.1 (P:) Meizothrombin {Cow (Bos taurus) [TaxId: 9913]} cvpdrgreyrgrlavttsgsrclawsseqakalskdqdfnpavplaenfcrnpdgdeega wcyvadqpgdfeycnlnyc
Timeline for d2hppp_: