Lineage for d2spt_1 (2spt 66-145)
- Root: SCOP 1.57
Class g: Small proteins [56992] (56 folds) 
Fold g.14: Kringle-like [57439] (1 superfamily) Superfamily g.14.1: Kringle-like [57440] (2 families) 
Family g.14.1.1: Kringle modules [57441] (7 proteins) 
Protein Prothrombin kringle domain [57448] (1 species) Species Cow (Bos taurus) [TaxId:9913] [57449] (3 PDB entries) 
Domain d2spt_1: 2spt 66-145 [44653]
Other proteins in same PDB: d2spt_2
Details for d2spt_1
PDB Entry: 2spt (more details), 2.5 Å
PDB Description: differences in the metal ion structure between sr-and ca-prothrombin fragment 1
SCOP Domain Sequences for d2spt_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2spt_1 g.14.1.1 (66-145) Prothrombin kringle domain {Cow (Bos taurus)}
caegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdgsitgp
wcyttsptlrreecsvpvcg
SCOP Domain Coordinates for d2spt_1:
Click to download the PDB-style file with coordinates for d2spt_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2spt_1:
- d2spt_1 first appeared (with stable ids) in SCOP 1.55
- d2spt_1 appears in SCOP 1.59
- d2spt_1 appears in the current release, SCOPe 2.08, called d2spta1
View in 3D
