Lineage for d2pf1_1 (2pf1 66-156)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 428891Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 428892Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 428893Family g.14.1.1: Kringle modules [57441] (6 proteins)
  6. 428959Protein Prothrombin [57448] (1 species)
  7. 428960Species Cow (Bos taurus) [TaxId:9913] [57449] (5 PDB entries)
  8. 428964Domain d2pf1_1: 2pf1 66-156 [44652]
    Other proteins in same PDB: d2pf1_2

Details for d2pf1_1

PDB Entry: 2pf1 (more details), 2.2 Å

PDB Description: structure of bovine prothrombin fragment 1 refined at 2.25 angstroms resolution

SCOP Domain Sequences for d2pf1_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pf1_1 g.14.1.1 (66-156) Prothrombin {Cow (Bos taurus)}
caegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdgsitgp
wcyttsptlrreecsvpvcgqdrvtvevipr

SCOP Domain Coordinates for d2pf1_1:

Click to download the PDB-style file with coordinates for d2pf1_1.
(The format of our PDB-style files is described here.)

Timeline for d2pf1_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pf1_2