Lineage for d1hpja_ (1hpj A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033340Protein Plasminogen [63400] (1 species)
  7. 3033341Species Human (Homo sapiens) [TaxId:9606] [63401] (20 PDB entries)
  8. 3033375Domain d1hpja_: 1hpj A: [44649]
    kringle 1

Details for d1hpja_

PDB Entry: 1hpj (more details)

PDB Description: solution nmr structure of the human plasminogen kringle 1 domain complexed with 6-aminohexanoic acid at ph 5.3, 310k, derived from randomly generated structures using simulated annealing, 12 structures
PDB Compounds: (A:) plasminogen

SCOPe Domain Sequences for d1hpja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hpja_ g.14.1.1 (A:) Plasminogen {Human (Homo sapiens) [TaxId: 9606]}
cktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpqgp
wcyttdpekrydycdilec

SCOPe Domain Coordinates for d1hpja_:

Click to download the PDB-style file with coordinates for d1hpja_.
(The format of our PDB-style files is described here.)

Timeline for d1hpja_: