Lineage for d1pkr__ (1pkr -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40632Fold g.14: Kringle-like [57439] (1 superfamily)
  4. 40633Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 40634Family g.14.1.1: Kringle modules [57441] (8 proteins)
  6. 40670Protein Plasminogen kringles [57446] (1 species)
  7. 40671Species Human (Homo sapiens) [TaxId:9606] [57447] (6 PDB entries)
  8. 40678Domain d1pkr__: 1pkr - [44646]

Details for d1pkr__

PDB Entry: 1pkr (more details), 2.48 Å

PDB Description: the structure of recombinant plasminogen kringle 1 and the fibrin binding site

SCOP Domain Sequences for d1pkr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkr__ g.14.1.1 (-) Plasminogen kringles {Human (Homo sapiens)}
ecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpqg
pwcyttdpekrydycdilec

SCOP Domain Coordinates for d1pkr__:

Click to download the PDB-style file with coordinates for d1pkr__.
(The format of our PDB-style files is described here.)

Timeline for d1pkr__: