SCOPe 2.08: Domain d1ceab_: 1cea B:

Lineage for d1ceab_ (1cea B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein Plasminogen [63400] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63401] (20 PDB entries)

8. Domain d1ceab_: 1cea B: [44645]
   kringle 1
   complexed with aca

Details for d1ceab_

PDB Entry: 1cea, 2.06 Å

PDB Description: the structure of the non-covalent complex of recombinant kringle 1 domain of human plasminogen with eaca (epsilon-aminocaproic acid)

PDB Compounds: (B:) plasminogen

SCOPe Domain Sequences for d1ceab_:

Sequence; same for both SEQRES and ATOM records:

>d1ceab_ g.14.1.1 (B:) Plasminogen {Human (Homo sapiens) [TaxId: 9606]}
ecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpqg
pwcyttdpekrydycdilec

Timeline for d1ceab_:

• d1ceab_ first appeared (with stable ids) in SCOP 1.55
  
• d1ceab_ appears in SCOPe 2.07