Lineage for d1ceaa_ (1cea A:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.14: Kringle-like [57439] (1 superfamily) Superfamily g.14.1: Kringle-like [57440] (2 families) 
Family g.14.1.1: Kringle modules [57441] (8 proteins) 
Protein Plasminogen kringles [57446] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57447] (6 PDB entries) 
Domain d1ceaa_: 1cea A: [44644]
Details for d1ceaa_
PDB Entry: 1cea (more details), 2.1 Å
PDB Description: the structure of the non-covalent complex of recombinant kringle 1 domain of human plasminogen with eaca (epsilon-aminocaproic acid)
SCOP Domain Sequences for d1ceaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ceaa_ g.14.1.1 (A:) Plasminogen kringles {Human (Homo sapiens)}
ecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpqg
pwcyttdpekrydycdilec
SCOP Domain Coordinates for d1ceaa_:
Click to download the PDB-style file with coordinates for d1ceaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ceaa_:
- d1ceaa_ appears in SCOP 1.57
- d1ceaa_ appears in the current release, SCOPe 2.08
View in 3D
