Lineage for d5hpga_ (5hpg A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623175Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 623176Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 623177Family g.14.1.1: Kringle modules [57441] (6 proteins)
  6. 623214Protein Plasminogen [63400] (1 species)
  7. 623215Species Human (Homo sapiens) [TaxId:9606] [63401] (16 PDB entries)
  8. 623217Domain d5hpga_: 5hpg A: [44642]

Details for d5hpga_

PDB Entry: 5hpg (more details), 1.66 Å

PDB Description: structure and ligand determinants of the recombinant kringle 5 domain of human plasminogen

SCOP Domain Sequences for d5hpga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hpga_ g.14.1.1 (A:) Plasminogen {Human (Homo sapiens)}
dcmfgngkgyrgkrvttvtgtpcqdwaaqephrhsiftpetnpragleknycrnpdgdvg
gpwcyttnprklydycdvpqcaap

SCOP Domain Coordinates for d5hpga_:

Click to download the PDB-style file with coordinates for d5hpga_.
(The format of our PDB-style files is described here.)

Timeline for d5hpga_:

623217
d5hpga_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d5hpgb_