Lineage for d1pk2__ (1pk2 -)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89571Fold g.14: Kringle-like [57439] (1 superfamily)
  4. 89572Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 89573Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 89605Protein Plasminogen kringles [63400] (1 species)
  7. 89606Species Human (Homo sapiens) [TaxId:9606] [63401] (9 PDB entries)
  8. 89621Domain d1pk2__: 1pk2 - [44641]

Details for d1pk2__

PDB Entry: 1pk2 (more details)

PDB Description: solution structure of the tissue-type plasminogen activator kringle 2 domain complexed to 6-aminohexanoic acid an antifibrinolytic drug

SCOP Domain Sequences for d1pk2__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pk2__ g.14.1.1 (-) Plasminogen kringles {Human (Homo sapiens)}
segnsdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycr
npdgdakpwchvlknrrltweycdvpscst

SCOP Domain Coordinates for d1pk2__:

Click to download the PDB-style file with coordinates for d1pk2__.
(The format of our PDB-style files is described here.)

Timeline for d1pk2__: