SCOP 1.55: Domain d1pk2__: 1pk2 -

Lineage for d1pk2__ (1pk2 -)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)

4. Superfamily g.14.1: Kringle-like [57440] (2 families)

5. Family g.14.1.1: Kringle modules [57441] (8 proteins)

6. Protein Plasminogen kringle 2 [57444] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57445] (3 PDB entries)

8. Domain d1pk2__: 1pk2 - [44641]

Details for d1pk2__

PDB Entry: 1pk2

PDB Description: solution structure of the tissue-type plasminogen activator kringle 2 domain complexed to 6-aminohexanoic acid an antifibrinolytic drug

SCOP Domain Sequences for d1pk2__:

Sequence; same for both SEQRES and ATOM records:

>d1pk2__ g.14.1.1 (-) Plasminogen kringle 2 {Human (Homo sapiens)}
segnsdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycr
npdgdakpwchvlknrrltweycdvpscst

Timeline for d1pk2__:

• d1pk2__ appears in SCOP 1.57
  
• d1pk2__ appears in the current release, SCOPe 2.08, called d1pk2a_