Lineage for d1b2ia_ (1b2i A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623175Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 623176Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 623177Family g.14.1.1: Kringle modules [57441] (6 proteins)
  6. 623214Protein Plasminogen [63400] (1 species)
  7. 623215Species Human (Homo sapiens) [TaxId:9606] [63401] (16 PDB entries)
  8. 623239Domain d1b2ia_: 1b2i A: [44640]
    kringle 2

Details for d1b2ia_

PDB Entry: 1b2i (more details)

PDB Description: kringle 2 domain of human plasminogen: nmr solution structure of trans-4-aminomethylcyclohexane-1-carboxylic acid (amcha) complex

SCOP Domain Sequences for d1b2ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b2ia_ g.14.1.1 (A:) Plasminogen {Human (Homo sapiens)}
tseecmhgsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdre
lrpwcfttdpnkrwelcdiprct

SCOP Domain Coordinates for d1b2ia_:

Click to download the PDB-style file with coordinates for d1b2ia_.
(The format of our PDB-style files is described here.)

Timeline for d1b2ia_: