Lineage for d1tpkb_ (1tpk B:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89571Fold g.14: Kringle-like [57439] (1 superfamily)
  4. 89572Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 89573Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 89605Protein Plasminogen kringles [63400] (1 species)
  7. 89606Species Human (Homo sapiens) [TaxId:9606] [63401] (9 PDB entries)
  8. 89614Domain d1tpkb_: 1tpk B: [44638]

Details for d1tpkb_

PDB Entry: 1tpk (more details), 2.4 Å

PDB Description: crystal structure of the kringle-2 domain of tissue plasminogen activator at 2.4-angstroms resolution

SCOP Domain Sequences for d1tpkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tpkb_ g.14.1.1 (B:) Plasminogen kringles {Human (Homo sapiens)}
gnsdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnp
dgdakpwchvlknrrltweycdvpscst

SCOP Domain Coordinates for d1tpkb_:

Click to download the PDB-style file with coordinates for d1tpkb_.
(The format of our PDB-style files is described here.)

Timeline for d1tpkb_: